prot_M-pyrifera_M_contig77166.18185.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77166.18185.1 vs. uniprot
Match: A0A388JRW7_CHABU (Uncharacterized protein n=2 Tax=Chara braunii TaxID=69332 RepID=A0A388JRW7_CHABU) HSP 1 Score: 47.8 bits (112), Expect = 7.730e-5 Identity = 22/52 (42.31%), Postives = 30/52 (57.69%), Query Frame = 0 Query: 1 MYQASLLRVVKKTAGEGLFPLFIVDSSHPSRRHLEDVWGAAKRAGFEAYVVD 52 +Y+AS+ + KKT EG F IVD + W AAKR+G+E YV+D Sbjct: 1213 VYKASMFKAFKKTLEEGRFTFIIVDDRNVLVADFSQYWAAAKRSGYEVYVLD 1264 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77166.18185.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77166.18185.1 ID=prot_M-pyrifera_M_contig77166.18185.1|Name=mRNA_M-pyrifera_M_contig77166.18185.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=53bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|