mRNA_M-pyrifera_M_contig77166.18185.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77166.18185.1 vs. uniprot
Match: A0A388JRW7_CHABU (Uncharacterized protein n=2 Tax=Chara braunii TaxID=69332 RepID=A0A388JRW7_CHABU) HSP 1 Score: 51.2 bits (121), Expect = 5.720e-6 Identity = 23/57 (40.35%), Postives = 33/57 (57.89%), Query Frame = 1 Query: 1 PPSQQMYQASLLRVVKKTAGEGLFPLFIVDSSHPSRRHLEDVWGAAKRAGFEAYVVD 171 P +++Y+AS+ + KKT EG F IVD + W AAKR+G+E YV+D Sbjct: 1208 PEMEEVYKASMFKAFKKTLEEGRFTFIIVDDRNVLVADFSQYWAAAKRSGYEVYVLD 1264 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77166.18185.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig77166.18185.1 >prot_M-pyrifera_M_contig77166.18185.1 ID=prot_M-pyrifera_M_contig77166.18185.1|Name=mRNA_M-pyrifera_M_contig77166.18185.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=53bp MYQASLLRVVKKTAGEGLFPLFIVDSSHPSRRHLEDVWGAAKRAGFEAYVback to top mRNA from alignment at M-pyrifera_M_contig77166:88..261+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig77166.18185.1 ID=mRNA_M-pyrifera_M_contig77166.18185.1|Name=mRNA_M-pyrifera_M_contig77166.18185.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=174bp|location=Sequence derived from alignment at M-pyrifera_M_contig77166:88..261+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig77166:88..261+ >mRNA_M-pyrifera_M_contig77166.18185.1 ID=mRNA_M-pyrifera_M_contig77166.18185.1|Name=mRNA_M-pyrifera_M_contig77166.18185.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=318bp|location=Sequence derived from alignment at M-pyrifera_M_contig77166:88..261+ (Macrocystis pyrifera P11B4 male)back to top |