Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..19 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 79..80 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 57..78 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 20..37 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 38..56 |
None | No IPR available | PRODOM | PD147088 | | coord: 18..70 e-value: 0.006 score: 87.0 |
None | No IPR available | TMHMM | TMhelix | | coord: 58..75 |
None | No IPR available | TMHMM | TMhelix | | coord: 15..37 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77070.18163.1 ID=prot_M-pyrifera_M_contig77070.18163.1|Name=mRNA_M-pyrifera_M_contig77070.18163.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=80bp MDGSSSRSPSRHRWSVRLTLLAGTLSLIVGWALWQLAEIASMNEMRQRLD SMHATTTGIRWGVIGFIAMGWPVVVRVVQR back to top
|