prot_M-pyrifera_M_contig76119.17956.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76119.17956.1 vs. uniprot
Match: A0A2V0NLE0_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0NLE0_9CHLO) HSP 1 Score: 60.5 bits (145), Expect = 3.660e-8 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 3 VKFHPDGSIVAGCMADGTVKLWDARCDALLQHYAAHSSA 41 V FHPDG+ +A C AD ++K+WD R DALLQHY AH+ A Sbjct: 204 VAFHPDGTALASCCADASIKIWDMRSDALLQHYRAHTGA 242
BLAST of mRNA_M-pyrifera_M_contig76119.17956.1 vs. uniprot
Match: A0A8J2F7Q1_9DINO (Hypothetical protein n=1 Tax=Amoebophrya sp. A25 TaxID=1410381 RepID=A0A8J2F7Q1_9DINO) HSP 1 Score: 51.6 bits (122), Expect = 4.660e-5 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 0 Query: 5 FHPDGSIVAGCMADGTVKLWDARCDALLQHYAAHSSAAHHID 46 FHPDG+ +A C D T+K+WD R L+QHY AH A +D Sbjct: 238 FHPDGTCIASCSDDRTIKIWDLRRRRLIQHYDAHGGAVLDLD 279 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76119.17956.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig76119.17956.1 ID=prot_M-pyrifera_M_contig76119.17956.1|Name=mRNA_M-pyrifera_M_contig76119.17956.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=125bpback to top |