prot_M-pyrifera_M_contig75934.17916.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75934.17916.1 vs. uniprot
Match: D7FH00_ECTSI (G_PROTEIN_RECEP_F3_4 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH00_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 4.450e-9 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = 0 Query: 1 IGLSVTFFSALALVGPNRAFTCALRLWLWSFGFDLAFGALVLKLWHALNAVE 52 +G+ VTF S AL+G TCALRLW +S GFDLAFGAL LK+ A +A E Sbjct: 176 VGIGVTFLSIFALLGATTDLTCALRLWGYSAGFDLAFGALTLKMRSACSAAE 227 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75934.17916.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75934.17916.1 ID=prot_M-pyrifera_M_contig75934.17916.1|Name=mRNA_M-pyrifera_M_contig75934.17916.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=52bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|