prot_M-pyrifera_M_contig75856.17894.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75856.17894.1 vs. uniprot
Match: A0A5K0VCH0_9MAGN (Uncharacterized protein (Fragment) n=1 Tax=Nymphaea colorata TaxID=210225 RepID=A0A5K0VCH0_9MAGN) HSP 1 Score: 52.0 bits (123), Expect = 4.230e-5 Identity = 37/125 (29.60%), Postives = 56/125 (44.80%), Query Frame = 0 Query: 8 YYGNCLSFIQKELPVEDVQTMPLAELAILVRTLVESYEAQDATDAVNLMKETYFNHGASGLVSLEPPMDYPTSMI-----VSNWAKFRSYDVDFGQGRPLRFVYPLWIAMPGVNIVNTRVGADGD 127 Y+GN + + E VED+ P+ A L+ +EA DA F+ L P D ++ V +W +F YDVDFG GRP RF+ P ++ + G+ I+ +GD Sbjct: 292 YFGNMVLWAWPESRVEDLLAKPIGHAARLI------HEAAARVDADYFKSFIDFSSSKEKTEGLMPSADEGKMVLSPDLEVDSWLRFPFYDVDFGSGRPHRFM-PSYLPVEGLLILVPSFSGNGD 409 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75856.17894.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75856.17894.1 ID=prot_M-pyrifera_M_contig75856.17894.1|Name=mRNA_M-pyrifera_M_contig75856.17894.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=134bpback to top |