prot_M-pyrifera_M_contig7569.17852.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7569.17852.1 vs. uniprot
Match: A0A6H5KV25_9PHAE (RGS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV25_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 3.260e-11 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 0 Query: 1 RHSHELFQEENINLWSEIIDFKRGEYAVPHLGRALDVGE---VSVLSASR 47 RHS E FQEEN++LW+EI DFK GEYA P++G AL+VGE + VL A R Sbjct: 119 RHSQEFFQEENVSLWTEISDFKTGEYAAPYMGTALEVGEGDSIVVLRAKR 168 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7569.17852.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7569.17852.1 ID=prot_M-pyrifera_M_contig7569.17852.1|Name=mRNA_M-pyrifera_M_contig7569.17852.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bpback to top |