prot_M-pyrifera_M_contig75687.17850.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75687.17850.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 5
ZOOM
x 1
POSITION
0
MTGNAQDVLVRSLRLFPYNWSAWLDLASLCLETDTVRDL5101520253035Expect = 1.00e-12 / Id = 83.78Expect = 1.59e-5 / Id = 57.14Expect = 4.08e-5 / Id = 57.14Expect = 5.56e-5 / Id = 51.28Expect = 7.65e-5 / Id = 57.14SequenceA0A6H5JHG7_9PHAEA0A251SHP1_HELANF4PLN6_CAVFAA0A2P6MPD3_9EUKAA0A426XXN8_ENSVE
Match NameE-valueIdentityDescription
A0A6H5JHG7_9PHAE1.000e-1283.78ANAPC8 domain-containing protein n=3 Tax=Ectocarpu... [more]
A0A251SHP1_HELAN1.590e-557.14Putative anaphase-promoting complex subunit 8 n=6 ... [more]
F4PLN6_CAVFA4.080e-557.14Anaphase promoting complex subunit 8 n=1 Tax=Caven... [more]
A0A2P6MPD3_9EUKA5.560e-551.28Phosphoenolpyruvate carboxykinase (ATP) n=1 Tax=Pl... [more]
A0A426XXN8_ENSVE7.650e-557.14Uncharacterized protein n=1 Tax=Ensete ventricosum... [more]
back to top