prot_M-pyrifera_M_contig75653.17845.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75653.17845.1 vs. uniprot
Match: A0A7I8W1M3_9ANNE (Hypothetical protein n=1 Tax=Dimorphilus gyrociliatus TaxID=2664684 RepID=A0A7I8W1M3_9ANNE) HSP 1 Score: 49.7 bits (117), Expect = 2.150e-5 Identity = 26/52 (50.00%), Postives = 32/52 (61.54%), Query Frame = 0 Query: 8 KRGWGVDEGVFYVGDGRGDLCPAMVLRKGDMVCAREKFPLAEELKRSPPPLE 59 K G D+ V YVGDG DLCPA+ LRK D+VC R F L + ++ PP E Sbjct: 166 KTNGGYDK-VMYVGDGYNDLCPALRLRKSDVVCPRIGFSLKKSIENLAPPHE 216
BLAST of mRNA_M-pyrifera_M_contig75653.17845.1 vs. uniprot
Match: A0A7C9EWX3_OPUST (Uncharacterized protein (Fragment) n=1 Tax=Opuntia streptacantha TaxID=393608 RepID=A0A7C9EWX3_OPUST) HSP 1 Score: 47.0 bits (110), Expect = 7.750e-5 Identity = 20/42 (47.62%), Postives = 26/42 (61.90%), Query Frame = 0 Query: 14 DEGVFYVGDGRGDLCPAMVLRKGDMVCAREKFPLAEELKRSP 55 D+ Y+GDG GD CP+M LRKGD R+ FPL + +P Sbjct: 36 DQTFIYLGDGNGDYCPSMKLRKGDYCMPRKNFPLWHVISSNP 77 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75653.17845.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75653.17845.1 ID=prot_M-pyrifera_M_contig75653.17845.1|Name=mRNA_M-pyrifera_M_contig75653.17845.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=65bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|