Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75090.17736.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 133..174 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 103..113 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..37 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 38..62 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 63..81 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 114..132 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 82..102 |
None | No IPR available | TMHMM | TMhelix | | coord: 34..56 |
None | No IPR available | TMHMM | TMhelix | | coord: 114..131 |
None | No IPR available | TMHMM | TMhelix | | coord: 77..99 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75090.17736.1 ID=prot_M-pyrifera_M_contig75090.17736.1|Name=mRNA_M-pyrifera_M_contig75090.17736.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=174bp IFQCSFLIFPFVNMLMNIKLAHKSVSLISEKPIINWPITSLIVCTSTTVD AIFSLWTAGDIYNSIERKATKTGADEYLNARWPYLAVLLTLVSIVLGLLS SSSRYYIATETMDWFVLAICIAINATIFESYAQRDLAGKIFESGACFFSP DKKLISSCRNLRRTIEILDVADND back to top
|