prot_M-pyrifera_M_contig75088.17735.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75088.17735.1 vs. uniprot
Match: A0A6H5JSC9_9PHAE (HK protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JSC9_9PHAE) HSP 1 Score: 85.9 bits (211), Expect = 2.540e-18 Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0 Query: 3 NFESLARDRIAAFSLTADVVKLTDEEAEWLSGVPGDEALRDPSCLKTLFPAAK 55 ++ESLAR+RI FSLTADVVKLTDEEAEWL G+PG+ ALRDP CL+ FPAAK Sbjct: 276 DYESLARERIMDFSLTADVVKLTDEEAEWLCGIPGEVALRDPPCLQRFFPAAK 328
BLAST of mRNA_M-pyrifera_M_contig75088.17735.1 vs. uniprot
Match: A0A1D2A3Y7_AUXPR (PfkB domain-containing protein n=2 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A1D2A3Y7_AUXPR) HSP 1 Score: 48.5 bits (114), Expect = 4.410e-5 Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 1 QANFESLARDRIAAFSLTADVVKLTDEEAEWLSGVPGDEALRDPSCLKTLFPAAK 55 +A E++A+ I F AD++K+T+EEAEWL G+PG AL P + P A+ Sbjct: 217 EAQGEAVAKATILDFIAAADLLKVTEEEAEWLWGIPGTRALEHPEEVLAKLPGAR 271 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75088.17735.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75088.17735.1 ID=prot_M-pyrifera_M_contig75088.17735.1|Name=mRNA_M-pyrifera_M_contig75088.17735.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bpback to top |