prot_M-pyrifera_M_contig74848.17693.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74848.17693.1 vs. uniprot
Match: A0A507ESL2_9FUNG (YTH domain-containing protein n=1 Tax=Spizellomyces sp. 'palustris' TaxID=117820 RepID=A0A507ESL2_9FUNG) HSP 1 Score: 50.4 bits (119), Expect = 2.080e-5 Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 13 PARYFVVKVPNEAMLRTCARRNAWGVERDIATKINHALRSCRAIFLFFSVVNSKGFQGVARL 74 P RYFV+ PN M++ NA+ I+TK++ A R+ R + LFF+V +S+ +QG AR+ Sbjct: 525 PIRYFVLISPNYDMIKQSQNINAFATIPAISTKLSEAYRNSRHVVLFFTVKDSRRWQGYARM 586
BLAST of mRNA_M-pyrifera_M_contig74848.17693.1 vs. uniprot
Match: A0A1X7V720_AMPQE (YTH domain-containing protein n=4 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7V720_AMPQE) HSP 1 Score: 49.7 bits (117), Expect = 3.800e-5 Identity = 26/63 (41.27%), Postives = 32/63 (50.79%), Query Frame = 0 Query: 12 VPARYFVVKVPNEAMLRTCARRNAWGVERDIATKINHALRSCRAIFLFFSVVNSKGFQGVARL 74 V RYFV+K N + +N W K+N A R CR + L FSV S GFQG A+L Sbjct: 162 VNTRYFVIKSNNYENVDIAKSKNVWSTLPYNEKKLNKAYRDCRNVLLIFSVKESGGFQGFAKL 224 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74848.17693.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74848.17693.1 ID=prot_M-pyrifera_M_contig74848.17693.1|Name=mRNA_M-pyrifera_M_contig74848.17693.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|