prot_M-pyrifera_M_contig74780.17682.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74780.17682.1 vs. uniprot
Match: D8LQ85_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LQ85_ECTSI) HSP 1 Score: 100 bits (248), Expect = 1.140e-23 Identity = 42/46 (91.30%), Postives = 44/46 (95.65%), Query Frame = 0 Query: 1 WNSVGFLFLTCYHWWWLAPVNIVTGVNVATMSVPPASLEMFGKYYR 46 WNSVGF+FLTCYHWWWLAPVN+ TGVNVATMSVPP SLEMFGKYYR Sbjct: 288 WNSVGFVFLTCYHWWWLAPVNLFTGVNVATMSVPPDSLEMFGKYYR 333
BLAST of mRNA_M-pyrifera_M_contig74780.17682.1 vs. uniprot
Match: A0A835Z0S0_9STRA (TMEM164 family-domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z0S0_9STRA) HSP 1 Score: 77.0 bits (188), Expect = 1.590e-15 Identity = 31/46 (67.39%), Postives = 40/46 (86.96%), Query Frame = 0 Query: 1 WNSVGFLFLTCYHWWWLAPVNIVTGVNVATMSVPPASLEMFGKYYR 46 WN+VG++ LTCYH+W+LAPV++VTG+NVATM VPP LE FG +YR Sbjct: 224 WNTVGYVLLTCYHFWFLAPVSLVTGINVATMMVPPDPLETFGAWYR 269 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74780.17682.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74780.17682.1 ID=prot_M-pyrifera_M_contig74780.17682.1|Name=mRNA_M-pyrifera_M_contig74780.17682.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=46bpback to top |