prot_M-pyrifera_M_contig74707.17670.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74707.17670.1 vs. uniprot
Match: A0A838WTC5_9CYAN (Uncharacterized protein (Fragment) n=2 Tax=Cylindrospermopsis raciborskii TaxID=77022 RepID=A0A838WTC5_9CYAN) HSP 1 Score: 50.8 bits (120), Expect = 1.710e-5 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 1 SGVVSIFSTTQAFAALKKDGSVVAWGHSSYGGSTSSVASEV 41 SGV IFST AFAALK DGSVV WG S+Y G +SSV+S + Sbjct: 3 SGVTQIFSTGNAFAALKSDGSVVTWGDSNYXGDSSSVSSSL 43 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74707.17670.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74707.17670.1 ID=prot_M-pyrifera_M_contig74707.17670.1|Name=mRNA_M-pyrifera_M_contig74707.17670.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=112bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|