Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74702.17669.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | GENE3D | 3.10.129.10 | | coord: 2..139 e-value: 1.4E-12 score: 49.5 |
IPR029069 | HotDog domain superfamily | SUPERFAMILY | 54637 | Thioesterase/thiol ester dehydrase-isomerase | coord: 3..136 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74702.17669.1 ID=prot_M-pyrifera_M_contig74702.17669.1|Name=mRNA_M-pyrifera_M_contig74702.17669.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=143bp PVAHLPHTGPARFVTRALETSAEHAVVEVRVPVGSAYRSAREGGAAGERV PAFLCIEFGAQAAAVLVGARAQLTERPPPGMLVSVRDAEFARAFLDADAA YRVTVEARQAAAPLLIFAFEVADVAGHEVARGELTLHVELPS* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR029069 | HotDog_dom_sf |
|