prot_M-pyrifera_M_contig74521.17636.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74521.17636.1 vs. uniprot
Match: F0ZKN4_DICPU (Uncharacterized protein n=1 Tax=Dictyostelium purpureum TaxID=5786 RepID=F0ZKN4_DICPU) HSP 1 Score: 65.9 bits (159), Expect = 4.210e-11 Identity = 30/58 (51.72%), Postives = 42/58 (72.41%), Query Frame = 0 Query: 3 WQYQHNGWQPYDGNASLLVERAFQEFQGNPGRCDVRSVRSGYFAYQVNFLGMKQTKIE 60 WQ++H GW YD +AS +VE A+QE+ NP DVRSV+SG++AYQ++F QT I+ Sbjct: 476 WQFEHGGWLDYDNDASKVVEEAYQEWLLNPN-IDVRSVKSGHWAYQIDFKHNTQTNIQ 532
BLAST of mRNA_M-pyrifera_M_contig74521.17636.1 vs. uniprot
Match: Q54E45_DICDI (Uncharacterized protein n=1 Tax=Dictyostelium discoideum TaxID=44689 RepID=Q54E45_DICDI) HSP 1 Score: 64.3 bits (155), Expect = 1.470e-10 Identity = 31/58 (53.45%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 3 WQYQHNGWQPYDGNASLLVERAFQEFQGNPGRCDVRSVRSGYFAYQVNFLGMKQTKIE 60 WQY H W YD +AS +VE A+QE+ NP DVRSV+SG +AYQ++F KQT I+ Sbjct: 579 WQYLHGTWNDYDNDASKVVEEAYQEWLTNP-YTDVRSVKSGAWAYQIDFKQNKQTNIQ 635 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74521.17636.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74521.17636.1 ID=prot_M-pyrifera_M_contig74521.17636.1|Name=mRNA_M-pyrifera_M_contig74521.17636.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=60bpback to top |