prot_M-pyrifera_M_contig74099.17547.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74099.17547.1 vs. uniprot
Match: A0A517PWW1_9PLAN (Uncharacterized protein n=1 Tax=Gimesia chilikensis TaxID=2605989 RepID=A0A517PWW1_9PLAN) HSP 1 Score: 73.2 bits (178), Expect = 3.590e-14 Identity = 39/89 (43.82%), Postives = 56/89 (62.92%), Query Frame = 0 Query: 2 KTLPEVVSKVYALLEPLESENRQKVMGSVMTLLGEQSLPT-----SSAKTSSPNLGGDEDPTFGPKVMRWLKQFEVPMTAIEEVFHIDG 85 KTLP++V ++ LL+PLESE+RQKV+ SVM LLG+ ++P K S + G +D T+G + RW+ Q + I E+FHIDG Sbjct: 4 KTLPQIVQDIFVLLDPLESEDRQKVVDSVMALLGD-AMPRPGRNDGEGKKDSGDAG--DDATYGQRAKRWMDQNNISAVMISEIFHIDG 89 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74099.17547.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74099.17547.1 ID=prot_M-pyrifera_M_contig74099.17547.1|Name=mRNA_M-pyrifera_M_contig74099.17547.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bpback to top |