prot_M-pyrifera_M_contig73652.17452.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: D7FTH5_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FTH5_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 1.040e-10 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 7 NEISEAFPEVPWVFVFRDPVEVMVSNLKSLAG 38 +ISEA+PEVPWVFVFRDPVEVMVSNLKS AG Sbjct: 280 KQISEAYPEVPWVFVFRDPVEVMVSNLKSYAG 311
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: B9XBL0_PEDPL (Aspartyl/asparaginyl beta-hydroxylase n=1 Tax=Pedosphaera parvula (strain Ellin514) TaxID=320771 RepID=B9XBL0_PEDPL) HSP 1 Score: 54.7 bits (130), Expect = 1.350e-7 Identity = 22/30 (73.33%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 9 ISEAFPEVPWVFVFRDPVEVMVSNLKSLAG 38 I +AFP+VPW+FV+R+PVEV+VSNLK LAG Sbjct: 164 IHKAFPDVPWIFVYREPVEVIVSNLKQLAG 193
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: A0A7S2S3F9_9STRA (Hypothetical protein n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2S3F9_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 2.330e-6 Identity = 20/32 (62.50%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 3 SRYINEISEAFPEVPWVFVFRDPVEVMVSNLK 34 ++YI+ AFPEVPW+FV+RDPV+VM+S+LK Sbjct: 253 TKYIDIARMAFPEVPWIFVYRDPVQVMMSHLK 284
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: A0A7S1ZRE9_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1ZRE9_TRICV) HSP 1 Score: 48.9 bits (115), Expect = 8.390e-6 Identity = 19/29 (65.52%), Postives = 24/29 (82.76%), Query Frame = 0 Query: 6 INEISEAFPEVPWVFVFRDPVEVMVSNLK 34 I EAFPE PW+FV+RDPV+VM+S+LK Sbjct: 2 IGAFREAFPETPWIFVYRDPVQVMMSHLK 30
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: K0RCZ6_THAOC (Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RCZ6_THAOC) HSP 1 Score: 49.3 bits (116), Expect = 1.110e-5 Identity = 18/31 (58.06%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 3 SRYINEISEAFPEVPWVFVFRDPVEVMVSNL 33 S+ IN +AFP+VPW+F+FRDPV+ M+S+L Sbjct: 328 SKRINLFQQAFPDVPWIFIFRDPVQTMMSHL 358
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: F2UI36_SALR5 (JmjC domain-containing protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UI36_SALR5) HSP 1 Score: 48.1 bits (113), Expect = 2.840e-5 Identity = 19/25 (76.00%), Postives = 23/25 (92.00%), Query Frame = 0 Query: 10 SEAFPEVPWVFVFRDPVEVMVSNLK 34 +EAFPEVPW+FV+RDPVEVM S+ K Sbjct: 219 TEAFPEVPWMFVYRDPVEVMASHFK 243
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: D7G7C8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7C8_ECTSI) HSP 1 Score: 48.1 bits (113), Expect = 2.850e-5 Identity = 20/30 (66.67%), Postives = 25/30 (83.33%), Query Frame = 0 Query: 9 ISEAFPEVPWVFVFRDPVEVMVSNLKSLAG 38 + +A+PEV WV++FRDPVEVMVSNLK A Sbjct: 193 MMKAYPEVGWVYLFRDPVEVMVSNLKCFAN 222
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: A0A6H5K3E4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3E4_9PHAE) HSP 1 Score: 48.1 bits (113), Expect = 2.850e-5 Identity = 20/30 (66.67%), Postives = 25/30 (83.33%), Query Frame = 0 Query: 9 ISEAFPEVPWVFVFRDPVEVMVSNLKSLAG 38 + +A+PEV WV++FRDPVEVMVSNLK G Sbjct: 317 MMKAYPEVGWVYLFRDPVEVMVSNLKGAYG 346
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: A0A7S2PC56_9STRA (Hypothetical protein (Fragment) n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2PC56_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 4.240e-5 Identity = 18/36 (50.00%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 3 SRYINEISEAFPEVPWVFVFRDPVEVMVSNLKSLAG 38 S +++ + AFP+VPW+FV+RDPV+VM+S+L + A Sbjct: 115 SLHVDIVQLAFPDVPWIFVYRDPVQVMMSHLANGAN 150
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Match: A0A7S3QBV4_9STRA (Hypothetical protein n=1 Tax=Chaetoceros debilis TaxID=122233 RepID=A0A7S3QBV4_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 5.330e-5 Identity = 17/32 (53.12%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 3 SRYINEISEAFPEVPWVFVFRDPVEVMVSNLK 34 S+ I+ +EA+PE PW++V+R+PV+VM+S+LK Sbjct: 301 SKSIHLFTEAYPETPWIYVYREPVQVMMSHLK 332 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73652.17452.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 18
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig73652.17452.1 ID=prot_M-pyrifera_M_contig73652.17452.1|Name=mRNA_M-pyrifera_M_contig73652.17452.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|