prot_M-pyrifera_M_contig73342.17395.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73342.17395.1 vs. uniprot
Match: A0A518D3F9_9BACT (PilZ domain-containing protein n=1 Tax=Planctomycetes bacterium Pla163 TaxID=2528008 RepID=A0A518D3F9_9BACT) HSP 1 Score: 48.9 bits (115), Expect = 7.360e-5 Identity = 25/67 (37.31%), Postives = 41/67 (61.19%), Query Frame = 0 Query: 41 GHTIDVSTAGARTEMMRPARVGDHYLMRLFTKEDQPVEV---VARCLRCILLTENRFEVALRFLAPL 104 G +D+S G R E+ P+ VGD +++ E++ VE+ ARCLRC + E R+E + +FL+P+ Sbjct: 57 GTLLDISRGGFRAELDAPSPVGD--VLQAVLVENEEVEIEPRFARCLRCAVAAEGRYEASFQFLSPV 121 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73342.17395.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig73342.17395.1 ID=prot_M-pyrifera_M_contig73342.17395.1|Name=mRNA_M-pyrifera_M_contig73342.17395.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|