prot_M-pyrifera_M_contig72670.17262.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_M-pyrifera_M_contig72670.17262.1
Unique Name	prot_M-pyrifera_M_contig72670.17262.1
Type	polypeptide
Organism	Macrocystis pyrifera P11B4 male (Macrocystis pyrifera P11B4 male (Giant kelp))
Sequence length	363

Homology

[Close]

BLAST of mRNA_M-pyrifera_M_contig72670.17262.1 vs. uniprot
Match: A0A7C2AI32_9BACT (Tetratricopeptide repeat protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7C2AI32_9BACT)

HSP 1 Score: 94.0 bits (232), Expect = 3.330e-17
Identity = 91/256 (35.55%), Postives = 116/256 (45.31%), Query Frame = 0

Query:   30 PPLVGAGSLGQTPFAARYVYVPVF----FAALGAGLLVRRAPAALALVAVVA--GVFAWRVQVHQATWDGPTAYYERVTEAYPRSPNGFWNLGETLRGRYIDSTAAADGSQGIGDLALLEDAFQAYESASRLLERAAKDATIPKDEL-----DYLQTGIGQAWSYLLQAEVDEYRDFDTPRRILEMLLERV--------LAREAVNRAEGYPRPPLPVEQVFNTLGIVELRAGDRTAAADAFRRALEQDPNYVPAL 266
            P LV  GSLG+ P + R++YVPV     F A+  G L  R  ++LAL+AV A  GV +W      A W      +E      PRS    W LG      Y+   A+       GD   L+ AF A+  A  LLE A +    P  +L     DYLQT +G A  Y ++A+ D Y  + T   ILE L  RV         AREA  R          +E V+  LG     AGD   A  A+R+AL  DP  V AL
Sbjct:  360 PVLVNVGSLGRFPLSDRFLYVPVLGFTTFVAVLFGRLPARGLSSLALLAVGALYGVRSW---TRIAIWRDEKTLFETAVRESPRSAYLQWGLGRV----YLQRLASG------GDPGELKKAFAAFGRAGDLLEEAKR----PGSDLFVTSNDYLQTNLGLAQCYTVEAQKDPYGSYGTSIAILEDLARRVGELEDQTRKAREAGLRVIDLHHR---LELVWAALGTAHRLAGDVEEADSAYRKALSLDPRCVEAL 595

[Close]

BLAST of mRNA_M-pyrifera_M_contig72670.17262.1 vs. uniprot
Match: A0A521K950_9BACT (Tetratricopeptide repeat protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A521K950_9BACT)

HSP 1 Score: 91.7 bits (226), Expect = 1.900e-16
Identity = 86/272 (31.62%), Postives = 118/272 (43.38%), Query Frame = 0

Query:    4 IGLAVAAWKRSGWGLLITLGFLAALLPPLVGA-GSLGQTPFAARYVYVPVFFAALGAGLLVRRAP-----AALALVAVVAGVFAWRVQVHQATWDGPTAYYERVTEAYPRSPNGFWNLGETLRGRYIDSTAAADGSQGIGDLALLEDAFQAYESASRLLERAAK-DATIPKDELDYLQTGIGQAWSYLLQAEVDEYRDFDTPRRILEMLLERVLAREAVNRAEGYPRPPLPVEQVFNTLGIVELRAGDRTAAADAFRRALEQDPNYVPALRN 268
            +G  V AW R  W  L  L FL A L PL+    SLGQ     R++YV    A +G      RAP       LAL+AV A   + R       W    A +ER     P SP  +W+LG      Y              D A LE + +A+E A  L ERA + D ++     D LQ+ +G  +  L +AE+DEYRD++TPR++ E            N A   P   LP+      L +V  + G+   +     +AL  +P    A RN
Sbjct:  319 LGALVLAWLRRAWTQLAWLLFLVASLAPLLARIESLGQFLLCDRFLYVSCL-AVVGLVATWERAPLRARAGLLALLAVAASALSLR---RIPVWASEQAMFERAIVETPESPYPWWSLGRVRINAYRKGH----------DTAQLEGSLRAFERAQDLCERALRGDGSVFATRADVLQSNLGVGYCLLYEAEIDEYRDWETPRKLFE------------NIAAMRPDSELPLVG----LALVASQRGEFAESERLLAKALSVNPRSAEAQRN 560

The following BLAST results are available for this feature:

BLAST of mRNA_M-pyrifera_M_contig72670.17262.1 vs. uniprot

BLAST of mRNA_M-pyrifera_M_contig72670.17262.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 2


Match Name	E-value	Identity	Description
A0A7C2AI32_9BACT	3.330e-17	35.55	Tetratricopeptide repeat protein n=1 Tax=Planctomy...	[more]
A0A521K950_9BACT	1.900e-16	31.62	Tetratricopeptide repeat protein n=1 Tax=Planctomy...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 142..162
None	No IPR available	PFAM	PF13432	TPR_16	coord: 235..297 e-value: 3.3E-10 score: 40.4
None	No IPR available	PANTHER	PTHR45586	FAMILY NOT NAMED	coord: 234..362 coord: 98..305
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 68..84
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 18..29
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 36..44
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 45..63
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 85..363
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..35
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 30..35
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..17
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 64..67
None	No IPR available	TMHMM	TMhelix		coord: 15..37
None	No IPR available	TMHMM	TMhelix		coord: 44..63
IPR019734	Tetratricopeptide repeat	SMART	SM00028	tpr_5	coord: 229..262 e-value: 0.021 score: 24.0 coord: 263..296 e-value: 0.12 score: 21.4
IPR019734	Tetratricopeptide repeat	PROSITE	PS50005	TPR	coord: 263..296 score: 8.998
IPR019734	Tetratricopeptide repeat	PROSITE	PS50005	TPR	coord: 297..330 score: 5.723
IPR019734	Tetratricopeptide repeat	PROSITE	PS50005	TPR	coord: 229..262 score: 10.797
IPR019734	Tetratricopeptide repeat	PROSITE	PS50005	TPR	coord: 331..363 score: 5.133
IPR011990	Tetratricopeptide-like helical domain superfamily	GENE3D	1.25.40.10		coord: 82..363 e-value: 7.6E-28 score: 99.5
IPR011990	Tetratricopeptide-like helical domain superfamily	SUPERFAMILY	48452	TPR-like	coord: 231..362
IPR013026	Tetratricopeptide repeat-containing domain	PROSITE	PS50293	TPR_REGION	coord: 229..363 score: 27.686

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
M-pyrifera_M_contig72670	contig	M-pyrifera_M_contig72670:12..1100 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0 of Macrocystis pyrifera male	2022-09-29
Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90	2022-09-16
OGS1.0 of Macrocystis pyrifera P11B4 male	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_M-pyrifera_M_contig72670.17262.1	mRNA_M-pyrifera_M_contig72670.17262.1	Macrocystis pyrifera P11B4 male	mRNA	M-pyrifera_M_contig72670 12..1100 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_M-pyrifera_M_contig72670.17262.1 ID=prot_M-pyrifera_M_contig72670.17262.1|Name=mRNA_M-pyrifera_M_contig72670.17262.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=363bp
ALAIGLAVAAWKRSGWGLLITLGFLAALLPPLVGAGSLGQTPFAARYVYV
PVFFAALGAGLLVRRAPAALALVAVVAGVFAWRVQVHQATWDGPTAYYER
VTEAYPRSPNGFWNLGETLRGRYIDSTAAADGSQGIGDLALLEDAFQAYE
SASRLLERAAKDATIPKDELDYLQTGIGQAWSYLLQAEVDEYRDFDTPRR
ILEMLLERVLAREAVNRAEGYPRPPLPVEQVFNTLGIVELRAGDRTAAAD
AFRRALEQDPNYVPALRNLGLVRLGNGEHALASQLLKRALDLVPDDPDVL
DPYARSLFEEGWPDRALELAEKLARIEPSSPTPATLRGLRAMQRRDFRTA
LNEFDRALEKSPR

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR019734	TPR_repeat
IPR011990	TPR-like_helical_dom_sf
IPR013026	TPR-contain_dom