prot_M-pyrifera_M_contig71250.16992.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig71250.16992.1 vs. uniprot
Match: D8LLU9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLU9_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 3.030e-13 Identity = 31/34 (91.18%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 1 VYCGYLATRGLRLETAMNAFRSWETLTSTRQLRN 34 VYCGYLATRGLRLE A NAFRSWETLTS RQLRN Sbjct: 29 VYCGYLATRGLRLEAATNAFRSWETLTSIRQLRN 62
BLAST of mRNA_M-pyrifera_M_contig71250.16992.1 vs. uniprot
Match: A0A6H5LKZ1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LKZ1_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 3.350e-12 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0 Query: 1 VYCGYLATRGLRLETAMNAFRSWETLTSTRQLRN 34 VYCGYLATRGLRLE A NAFRSWETLTSTRQLRN Sbjct: 356 VYCGYLATRGLRLEAATNAFRSWETLTSTRQLRN 389 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig71250.16992.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig71250.16992.1 ID=prot_M-pyrifera_M_contig71250.16992.1|Name=mRNA_M-pyrifera_M_contig71250.16992.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bpback to top |