prot_M-pyrifera_M_contig126448.5325.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_M-pyrifera_M_contig126448.5325.1
Unique Name	prot_M-pyrifera_M_contig126448.5325.1
Type	polypeptide
Organism	Macrocystis pyrifera P11B4 male (Macrocystis pyrifera P11B4 male (Giant kelp))
Sequence length	141

Homology

[Close]

BLAST of mRNA_M-pyrifera_M_contig126448.5325.1 vs. uniprot
Match: A0A2A5D880_9BACT (Glyco_hydro_20b domain-containing protein n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5D880_9BACT)

HSP 1 Score: 56.2 bits (134), Expect = 1.910e-6
Identity = 34/138 (24.64%), Postives = 63/138 (45.65%), Query Frame = 0

Query:    1 MWLVSSLLALSALALTPTPKDLSVNEDDTFYLRGDTMVVLPDAFVDQRDTLLAPLAPALAGDPQVAPASRVDKVPKAVYLATVAHRGALEKRKLRRYYTDSDTLPPAGYRITVDKLGVVLVAADEAGLAYGVHALAGL 138
            MW   ++  LS     P P+ + V  D  F +  +  V++ ++    +   +      L     +  AS  +   KA++++ V       +R ++      D  P  GYR+ VD+ G++LV AD+ GL +G+  L+ L
Sbjct:    1 MWSWVAVTVLSLTPFAPAPQSMEVGSDSVFTVTANMPVIIANSTPSSQIRTIEKTFNGLGMSLPIVRASGYEIGEKAIHISVVGQFSERSQRSMKSRIDAMDPTPAGGYRLVVDRTGIMLVGADQIGLRHGLITLSNL 138

The following BLAST results are available for this feature:

BLAST of mRNA_M-pyrifera_M_contig126448.5325.1 vs. uniprot

BLAST of mRNA_M-pyrifera_M_contig126448.5325.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
A0A2A5D880_9BACT	1.910e-6	24.64	Glyco_hydro_20b domain-containing protein n=1 Tax=...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR029018	Beta-hexosaminidase-like, domain 2	GENE3D	3.30.379.10		coord: 7..141 e-value: 7.5E-13 score: 50.8
IPR029018	Beta-hexosaminidase-like, domain 2	SUPERFAMILY	55545	beta-N-acetylhexosaminidase-like domain	coord: 9..139
IPR015882	Beta-hexosaminidase, bacterial type, N-terminal	PFAM	PF02838	Glyco_hydro_20b	coord: 14..139 e-value: 3.3E-9 score: 37.6
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..14
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 15..141
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 3..10
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 11..14
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..2
None	No IPR available	SIGNALP_EUK	SignalP-noTM	SignalP-noTM	coord: 1..14 score: 0.707

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
M-pyrifera_M_contig126448	contig	M-pyrifera_M_contig126448:84..506 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0 of Macrocystis pyrifera male	2022-09-29
Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90	2022-09-16
OGS1.0 of Macrocystis pyrifera P11B4 male	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_M-pyrifera_M_contig126448.5325.1	mRNA_M-pyrifera_M_contig126448.5325.1	Macrocystis pyrifera P11B4 male	mRNA	M-pyrifera_M_contig126448 84..506 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_M-pyrifera_M_contig126448.5325.1 ID=prot_M-pyrifera_M_contig126448.5325.1|Name=mRNA_M-pyrifera_M_contig126448.5325.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=141bp
MWLVSSLLALSALALTPTPKDLSVNEDDTFYLRGDTMVVLPDAFVDQRDT
LLAPLAPALAGDPQVAPASRVDKVPKAVYLATVAHRGALEKRKLRRYYTD
SDTLPPAGYRITVDKLGVVLVAADEAGLAYGVHALAGLVAE

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR029018	Hex-like_dom2
IPR015882	HEX_bac_N