prot_M-pyrifera_M_contig108953.1874.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A8H4AUA6_GIGMA (tRNA uridine 5-carboxymethylaminomethyl modification enzyme n=1 Tax=Gigaspora margarita TaxID=4874 RepID=A0A8H4AUA6_GIGMA) HSP 1 Score: 48.9 bits (115), Expect = 2.730e-5 Identity = 17/38 (44.74%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 7 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHT 44 CVEC + +++ C+QC +++C CFA +HR+G R +HT Sbjct: 256 CVECRDQDSLFFCEQCNEEFCEVCFAMIHRTGSRRIHT 293
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A8H4EQB6_GIGMA (tRNA uridine 5-carboxymethylaminomethyl modification enzyme n=3 Tax=Gigaspora margarita TaxID=4874 RepID=A0A8H4EQB6_GIGMA) HSP 1 Score: 48.9 bits (115), Expect = 2.750e-5 Identity = 17/38 (44.74%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 7 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHT 44 CVEC + +++ C+QC +++C CFA +HR+G R +HT Sbjct: 256 CVECRDQDSLFFCEQCNEEFCEVCFAMIHRTGSRRIHT 293
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: D3B3Y9_POLPP (B box-type domain-containing protein n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B3Y9_POLPP) HSP 1 Score: 48.5 bits (114), Expect = 3.760e-5 Identity = 21/40 (52.50%), Postives = 26/40 (65.00%), Query Frame = 0 Query: 7 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHTWS 46 CVEC + A CDQC DD C C S+HR G+R LHT++ Sbjct: 123 CVECTDQPASIHCDQCQDDLCEVCGYSIHRRGKRKLHTYT 162
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A8D0EFZ3_9SAUR (B box-type domain-containing protein n=1 Tax=Salvator merianae TaxID=96440 RepID=A0A8D0EFZ3_9SAUR) HSP 1 Score: 47.8 bits (112), Expect = 7.040e-5 Identity = 17/37 (45.95%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 7 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALH 43 C +C ++ A+ C +CG+DYC SCFAS+H+ G H Sbjct: 137 CGQCEIKTALLVCLECGEDYCPSCFASMHQKGALKFH 173
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A482V1V8_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482V1V8_9ARCH) HSP 1 Score: 47.8 bits (112), Expect = 7.050e-5 Identity = 19/44 (43.18%), Postives = 25/44 (56.82%), Query Frame = 0 Query: 7 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHTWSVYRP 50 C EC RVA+ TC++CGD +C C+ LH G R H + P Sbjct: 860 CTECNERVAIVTCEECGDIFCTKCYKFLHALGARRSHHHTPLGP 903 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig108953.1874.1 ID=prot_M-pyrifera_M_contig108953.1874.1|Name=mRNA_M-pyrifera_M_contig108953.1874.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=51bpback to top |