mRNA_M-pyrifera_M_contig108953.1874.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A8H4AUA6_GIGMA (tRNA uridine 5-carboxymethylaminomethyl modification enzyme n=1 Tax=Gigaspora margarita TaxID=4874 RepID=A0A8H4AUA6_GIGMA) HSP 1 Score: 48.9 bits (115), Expect = 2.730e-5 Identity = 17/38 (44.74%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 19 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHT 132 CVEC + +++ C+QC +++C CFA +HR+G R +HT Sbjct: 256 CVECRDQDSLFFCEQCNEEFCEVCFAMIHRTGSRRIHT 293
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A8H4EQB6_GIGMA (tRNA uridine 5-carboxymethylaminomethyl modification enzyme n=3 Tax=Gigaspora margarita TaxID=4874 RepID=A0A8H4EQB6_GIGMA) HSP 1 Score: 48.9 bits (115), Expect = 2.750e-5 Identity = 17/38 (44.74%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 19 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHT 132 CVEC + +++ C+QC +++C CFA +HR+G R +HT Sbjct: 256 CVECRDQDSLFFCEQCNEEFCEVCFAMIHRTGSRRIHT 293
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: D3B3Y9_POLPP (B box-type domain-containing protein n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B3Y9_POLPP) HSP 1 Score: 48.5 bits (114), Expect = 3.760e-5 Identity = 21/40 (52.50%), Postives = 26/40 (65.00%), Query Frame = 1 Query: 19 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHTWS 138 CVEC + A CDQC DD C C S+HR G+R LHT++ Sbjct: 123 CVECTDQPASIHCDQCQDDLCEVCGYSIHRRGKRKLHTYT 162
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A8D0EFZ3_9SAUR (B box-type domain-containing protein n=1 Tax=Salvator merianae TaxID=96440 RepID=A0A8D0EFZ3_9SAUR) HSP 1 Score: 47.8 bits (112), Expect = 7.040e-5 Identity = 17/37 (45.95%), Postives = 25/37 (67.57%), Query Frame = 1 Query: 19 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALH 129 C +C ++ A+ C +CG+DYC SCFAS+H+ G H Sbjct: 137 CGQCEIKTALLVCLECGEDYCPSCFASMHQKGALKFH 173
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Match: A0A482V1V8_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482V1V8_9ARCH) HSP 1 Score: 47.8 bits (112), Expect = 7.050e-5 Identity = 19/44 (43.18%), Postives = 25/44 (56.82%), Query Frame = 1 Query: 19 CVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHTWSVYRP 150 C EC RVA+ TC++CGD +C C+ LH G R H + P Sbjct: 860 CTECNERVAIVTCEECGDIFCTKCYKFLHALGARRSHHHTPLGP 903 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108953.1874.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108953.1874.1 >prot_M-pyrifera_M_contig108953.1874.1 ID=prot_M-pyrifera_M_contig108953.1874.1|Name=mRNA_M-pyrifera_M_contig108953.1874.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=51bp GEGRTQCVECGVRVAVWTCDQCGDDYCRSCFASLHRSGRRALHTWSVYRPback to top mRNA from alignment at M-pyrifera_M_contig108953:41..193- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108953.1874.1 ID=mRNA_M-pyrifera_M_contig108953.1874.1|Name=mRNA_M-pyrifera_M_contig108953.1874.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig108953:41..193- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108953:41..193- >mRNA_M-pyrifera_M_contig108953.1874.1 ID=mRNA_M-pyrifera_M_contig108953.1874.1|Name=mRNA_M-pyrifera_M_contig108953.1874.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=306bp|location=Sequence derived from alignment at M-pyrifera_M_contig108953:41..193- (Macrocystis pyrifera P11B4 male)back to top |