prot_M-pyrifera_M_contig108738.1838.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108738.1838.1 vs. uniprot
Match: A0A1H6ZXF7_9BACT (Uncharacterized protein n=2 Tax=Cyclobacterium xiamenense TaxID=1297121 RepID=A0A1H6ZXF7_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 1.560e-6 Identity = 40/96 (41.67%), Postives = 55/96 (57.29%), Query Frame = 0 Query: 15 FGSFQSIQLLSNADGDLYLVGFHTSRDGE--ELADLFAVDLRQSPEKTLRKIASRTITLSEDNHFRYAAGLWI-DGDRLRLLASERNLETTTRLTV 107 + S+Q+I L ++ LYLVG T RDGE ++ DLF + +SP +LRK+AS+ E F+ AAGL I G L LL + LE TR+ V Sbjct: 225 WNSYQNINLFTDQQERLYLVG--TGRDGEGNQVGDLFELQTEESP-PSLRKLASKVFHPGEPVDFKAAAGLVIGSGGSLELLGAPYQLEGRTRIDV 317 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108738.1838.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig108738.1838.1 ID=prot_M-pyrifera_M_contig108738.1838.1|Name=mRNA_M-pyrifera_M_contig108738.1838.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bpback to top |