mRNA_M-pyrifera_M_contig108738.1838.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108738.1838.1 vs. uniprot
Match: A0A1H6ZXF7_9BACT (Uncharacterized protein n=2 Tax=Cyclobacterium xiamenense TaxID=1297121 RepID=A0A1H6ZXF7_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 1.560e-6 Identity = 40/96 (41.67%), Postives = 55/96 (57.29%), Query Frame = 1 Query: 43 FGSFQSIQLLSNADGDLYLVGFHTSRDGE--ELADLFAVDLRQSPEKTLRKIASRTITLSEDNHFRYAAGLWI-DGDRLRLLASERNLETTTRLTV 321 + S+Q+I L ++ LYLVG T RDGE ++ DLF + +SP +LRK+AS+ E F+ AAGL I G L LL + LE TR+ V Sbjct: 225 WNSYQNINLFTDQQERLYLVG--TGRDGEGNQVGDLFELQTEESP-PSLRKLASKVFHPGEPVDFKAAAGLVIGSGGSLELLGAPYQLEGRTRIDV 317 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108738.1838.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108738.1838.1 >prot_M-pyrifera_M_contig108738.1838.1 ID=prot_M-pyrifera_M_contig108738.1838.1|Name=mRNA_M-pyrifera_M_contig108738.1838.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bp ASTAATTDWALSRLFGSFQSIQLLSNADGDLYLVGFHTSRDGEELADLFAback to top mRNA from alignment at M-pyrifera_M_contig108738:56..385+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108738.1838.1 ID=mRNA_M-pyrifera_M_contig108738.1838.1|Name=mRNA_M-pyrifera_M_contig108738.1838.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig108738:56..385+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108738:56..385+ >mRNA_M-pyrifera_M_contig108738.1838.1 ID=mRNA_M-pyrifera_M_contig108738.1838.1|Name=mRNA_M-pyrifera_M_contig108738.1838.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=660bp|location=Sequence derived from alignment at M-pyrifera_M_contig108738:56..385+ (Macrocystis pyrifera P11B4 male)back to top |