prot_M-pyrifera_M_contig108309.1768.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: F2URM6_SALR5 (Uncharacterized protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2URM6_SALR5) HSP 1 Score: 57.8 bits (138), Expect = 2.330e-9 Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEM 37 PER+FPGR D+W HSHQ WH+FV+LAA+ Y+ M Sbjct: 66 FPERFFPGRFDIWFHSHQLWHIFVILAAYAHYLCM 100
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A7S1C3L3_9STRA (Hypothetical protein n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1C3L3_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 3.260e-9 Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 0 Query: 1 MHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQ 44 + +PER+ PGR DVW HSHQ +H+ VV AA+IWY M+ W+ Sbjct: 430 LRVPERFAPGRFDVWCHSHQLFHVAVVAAAYIWYTHMQQLYAWR 473
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A0S4JQM0_BODSA (Haemolysin-III related protein, putative n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4JQM0_BODSA) HSP 1 Score: 58.9 bits (141), Expect = 3.890e-9 Identity = 20/30 (66.67%), Postives = 26/30 (86.67%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFI 32 +PERWFPGR D+W+HSHQ WH+FV+ AA + Sbjct: 197 VPERWFPGRFDIWLHSHQLWHVFVLCAAMV 226
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A2T9YS10_9FUNG (Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YS10_9FUNG) HSP 1 Score: 59.3 bits (142), Expect = 4.290e-9 Identity = 22/43 (51.16%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQH 45 +PERWFPG+ D+W HSHQ +H FVV AA+ Y + + + W H Sbjct: 303 VPERWFPGKFDIWFHSHQIFHYFVVTAAYFHYFSVINSLKWLH 345
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A6A0H3K4_HYAAZ (Uncharacterized protein n=1 Tax=Hyalella azteca TaxID=294128 RepID=A0A6A0H3K4_HYAAZ) HSP 1 Score: 56.2 bits (134), Expect = 6.420e-9 Identity = 21/43 (48.84%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQH 45 +PERWFPG+ D+W HSHQ +H VV AAF+ Y + +++H Sbjct: 50 VPERWFPGKCDLWFHSHQIFHTLVVAAAFVHYHGISRMAMYRH 92
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: Q4Q0K9_LEIMA (Uncharacterized protein n=8 Tax=Leishmania TaxID=5658 RepID=Q4Q0K9_LEIMA) HSP 1 Score: 58.5 bits (140), Expect = 7.900e-9 Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYME-MEDFVVWQ 44 +PERW+PGR DVW+HSHQ WH FV+ AA + Y + F +W Sbjct: 285 VPERWYPGRFDVWLHSHQLWHFFVLCAAVVHYFTCIAAFQMWH 327
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A1E1J9W7_LEIGU (Uncharacterized protein n=4 Tax=Viannia TaxID=37616 RepID=A0A1E1J9W7_LEIGU) HSP 1 Score: 58.5 bits (140), Expect = 7.900e-9 Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYME-MEDFVVWQ 44 +PERW+PGR DVW+HSHQ WH FV+ AA + Y + F +W+ Sbjct: 285 VPERWYPGRFDVWLHSHQLWHFFVLCAAVVHYFTCIGAFQMWR 327
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A836GDA5_9TRYP (Uncharacterized protein n=5 Tax=Leishmania TaxID=5658 RepID=A0A836GDA5_9TRYP) HSP 1 Score: 58.5 bits (140), Expect = 7.900e-9 Identity = 23/43 (53.49%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYME-MEDFVVWQ 44 +PERW+PG+ DVW+HSHQ WHLFV+ AA + Y + F +W+ Sbjct: 285 VPERWYPGQFDVWLHSHQLWHLFVLCAAVVHYFTCIGAFQMWR 327
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A1Y1WAA6_9FUNG (Putative hemolysin-III channel protein Izh2 n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1WAA6_9FUNG) HSP 1 Score: 58.2 bits (139), Expect = 1.010e-8 Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQH 45 IPERWFPG+ D W+HSHQ +H+FVV+AA Y+ + + W H Sbjct: 252 IPERWFPGKCDYWLHSHQIFHVFVVIAAVFHYVGVVRALRWTH 294
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A6M2E014_9NEOP (Putative product n=1 Tax=Xenopsylla cheopis TaxID=163159 RepID=A0A6M2E014_9NEOP) HSP 1 Score: 55.1 bits (131), Expect = 1.090e-8 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0 Query: 3 IPERWFPGRVDVWMHSHQFWHLFVVLAAFIWY 34 IPERWF GRVD HSHQ+WH+FVVLA + W+ Sbjct: 34 IPERWFSGRVDYLGHSHQWWHIFVVLALYYWH 65 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig108309.1768.1 ID=prot_M-pyrifera_M_contig108309.1768.1|Name=mRNA_M-pyrifera_M_contig108309.1768.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|