mRNA_M-pyrifera_M_contig108309.1768.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A7S1C3L3_9STRA (Hypothetical protein n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1C3L3_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 8.360e-11 Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQ 138 YS+ +PER+ PGR DVW HSHQ +H+ VV AA+IWY M+ W+ Sbjct: 428 YSLRVPERFAPGRFDVWCHSHQLFHVAVVAAAYIWYTHMQQLYAWR 473
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A6A0H3K4_HYAAZ (Uncharacterized protein n=1 Tax=Hyalella azteca TaxID=294128 RepID=A0A6A0H3K4_HYAAZ) HSP 1 Score: 59.7 bits (143), Expect = 3.070e-10 Identity = 22/47 (46.81%), Postives = 33/47 (70.21%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQH 141 Y++ +PERWFPG+ D+W HSHQ +H VV AAF+ Y + +++H Sbjct: 46 YAVRVPERWFPGKCDLWFHSHQIFHTLVVAAAFVHYHGISRMAMYRH 92
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A2T9YS10_9FUNG (Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YS10_9FUNG) HSP 1 Score: 61.6 bits (148), Expect = 7.040e-10 Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQH 141 Y +PERWFPG+ D+W HSHQ +H FVV AA+ Y + + + W H Sbjct: 299 YGSRVPERWFPGKFDIWFHSHQIFHYFVVTAAYFHYFSVINSLKWLH 345
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A0S4JQM0_BODSA (Haemolysin-III related protein, putative n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4JQM0_BODSA) HSP 1 Score: 60.5 bits (145), Expect = 1.140e-9 Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFI 102 Y +PERWFPGR D+W+HSHQ WH+FV+ AA + Sbjct: 193 YIFKVPERWFPGRFDIWLHSHQLWHVFVLCAAMV 226
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: W2TST5_NECAM (Uncharacterized protein n=2 Tax=Strongylida TaxID=6308 RepID=W2TST5_NECAM) HSP 1 Score: 57.8 bits (138), Expect = 1.250e-9 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFI 102 Y+ IPERWFPGR D+W SHQ +H FVV+AAFI Sbjct: 12 YATRIPERWFPGRCDLWFQSHQLFHTFVVIAAFI 45
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A087TWU3_STEMI (ADIPOR-like receptor (Fragment) n=2 Tax=Stegodyphus TaxID=175340 RepID=A0A087TWU3_STEMI) HSP 1 Score: 57.0 bits (136), Expect = 1.320e-9 Identity = 20/46 (43.48%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQ 138 Y++ +PER+FPG+ D+W HSHQ +H+ V+ AAF+ Y + + V++ Sbjct: 12 YALRVPERFFPGKCDIWFHSHQIFHVLVIAAAFVHYHGISEMAVYR 57
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A1Y1WAA6_9FUNG (Putative hemolysin-III channel protein Izh2 n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1WAA6_9FUNG) HSP 1 Score: 60.5 bits (145), Expect = 1.620e-9 Identity = 24/47 (51.06%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQH 141 Y IPERWFPG+ D W+HSHQ +H+FVV+AA Y+ + + W H Sbjct: 248 YGTRIPERWFPGKCDYWLHSHQIFHVFVVIAAVFHYVGVVRALRWTH 294
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A3P7KRB9_STRVU (Uncharacterized protein n=1 Tax=Strongylus vulgaris TaxID=40348 RepID=A0A3P7KRB9_STRVU) HSP 1 Score: 57.8 bits (138), Expect = 1.630e-9 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFI 102 Y+ IPERWFPGR D+W SHQ +H FVV+AAFI Sbjct: 23 YATRIPERWFPGRCDLWFQSHQLFHTFVVIAAFI 56
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A1E1J9W7_LEIGU (Uncharacterized protein n=4 Tax=Viannia TaxID=37616 RepID=A0A1E1J9W7_LEIGU) HSP 1 Score: 60.5 bits (145), Expect = 1.770e-9 Identity = 24/47 (51.06%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYME-MEDFVVWQ 138 Y +PERW+PGR DVW+HSHQ WH FV+ AA + Y + F +W+ Sbjct: 281 YIFQVPERWYPGRFDVWLHSHQLWHFFVLCAAVVHYFTCIGAFQMWR 327
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Match: A0A5N5T1D5_9CRUS (Adiponectin receptor protein n=2 Tax=Armadillidium TaxID=13346 RepID=A0A5N5T1D5_9CRUS) HSP 1 Score: 59.3 bits (142), Expect = 2.210e-9 Identity = 21/46 (45.65%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 1 YSMHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQ 138 Y++ IPERWFPG+ D+W HSHQ +H+ V+ AAF+ Y + + +++ Sbjct: 148 YAVRIPERWFPGKCDLWFHSHQLFHILVIAAAFVHYHGISEMAMYR 193 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108309.1768.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108309.1768.1 >prot_M-pyrifera_M_contig108309.1768.1 ID=prot_M-pyrifera_M_contig108309.1768.1|Name=mRNA_M-pyrifera_M_contig108309.1768.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bp MHIPERWFPGRVDVWMHSHQFWHLFVVLAAFIWYMEMEDFVVWQHback to top mRNA from alignment at M-pyrifera_M_contig108309:3..206+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108309.1768.1 ID=mRNA_M-pyrifera_M_contig108309.1768.1|Name=mRNA_M-pyrifera_M_contig108309.1768.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=204bp|location=Sequence derived from alignment at M-pyrifera_M_contig108309:3..206+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108309:3..206+ >mRNA_M-pyrifera_M_contig108309.1768.1 ID=mRNA_M-pyrifera_M_contig108309.1768.1|Name=mRNA_M-pyrifera_M_contig108309.1768.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=270bp|location=Sequence derived from alignment at M-pyrifera_M_contig108309:3..206+ (Macrocystis pyrifera P11B4 male)back to top |