prot_M-pyrifera_M_contig108127.1725.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108127.1725.1 vs. uniprot
Match: A0A2G4G8N4_9BACT (Uncharacterized protein n=1 Tax=Opitutae bacterium TaxID=2026771 RepID=A0A2G4G8N4_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 1.060e-7 Identity = 25/46 (54.35%), Postives = 31/46 (67.39%), Query Frame = 0 Query: 1 ILLNPNCELELNFVPLRTLSLLVEQGPRYDATVALRQAVGEWLPWF 46 +LLNPNCE LNFVPLRT + +V + +DA A A+ EWLP F Sbjct: 262 VLLNPNCEFPLNFVPLRTFAAIVRESGAWDARAAYLAAMSEWLPRF 307
BLAST of mRNA_M-pyrifera_M_contig108127.1725.1 vs. uniprot
Match: A0A2V5MMT0_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5MMT0_9BACT) HSP 1 Score: 49.7 bits (117), Expect = 1.170e-5 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 0 Query: 1 ILLNPNCELELNFVPLRTLSLLVEQGPRYDATVALRQAVGEWLP 44 IL NPNCE E+NFVPLRTL++ +Y+ A+ EWLP Sbjct: 270 ILSNPNCEFEVNFVPLRTLAMYAHATDKYEPRATYLAALKEWLP 313 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108127.1725.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig108127.1725.1 ID=prot_M-pyrifera_M_contig108127.1725.1|Name=mRNA_M-pyrifera_M_contig108127.1725.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=46bpback to top |