mRNA_M-pyrifera_M_contig108127.1725.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108127.1725.1 vs. uniprot
Match: A0A2G4G8N4_9BACT (Uncharacterized protein n=1 Tax=Opitutae bacterium TaxID=2026771 RepID=A0A2G4G8N4_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 1.060e-7 Identity = 25/46 (54.35%), Postives = 31/46 (67.39%), Query Frame = 1 Query: 1 ILLNPNCELELNFVPLRTLSLLVEQGPRYDATVALRQAVGEWLPWF 138 +LLNPNCE LNFVPLRT + +V + +DA A A+ EWLP F Sbjct: 262 VLLNPNCEFPLNFVPLRTFAAIVRESGAWDARAAYLAAMSEWLPRF 307
BLAST of mRNA_M-pyrifera_M_contig108127.1725.1 vs. uniprot
Match: A0A2V5MMT0_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5MMT0_9BACT) HSP 1 Score: 49.7 bits (117), Expect = 1.170e-5 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 1 Query: 1 ILLNPNCELELNFVPLRTLSLLVEQGPRYDATVALRQAVGEWLP 132 IL NPNCE E+NFVPLRTL++ +Y+ A+ EWLP Sbjct: 270 ILSNPNCEFEVNFVPLRTLAMYAHATDKYEPRATYLAALKEWLP 313 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108127.1725.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108127.1725.1 >prot_M-pyrifera_M_contig108127.1725.1 ID=prot_M-pyrifera_M_contig108127.1725.1|Name=mRNA_M-pyrifera_M_contig108127.1725.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=46bp ILLNPNCELELNFVPLRTLSLLVEQGPRYDATVALRQAVGEWLPWFback to top mRNA from alignment at M-pyrifera_M_contig108127:2..139+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108127.1725.1 ID=mRNA_M-pyrifera_M_contig108127.1725.1|Name=mRNA_M-pyrifera_M_contig108127.1725.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=138bp|location=Sequence derived from alignment at M-pyrifera_M_contig108127:2..139+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108127:2..139+ >mRNA_M-pyrifera_M_contig108127.1725.1 ID=mRNA_M-pyrifera_M_contig108127.1725.1|Name=mRNA_M-pyrifera_M_contig108127.1725.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=276bp|location=Sequence derived from alignment at M-pyrifera_M_contig108127:2..139+ (Macrocystis pyrifera P11B4 male)back to top |