prot_M-pyrifera_M_contig108042.1711.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108042.1711.1 vs. uniprot
Match: A9V6M3_MONBE (Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V6M3_MONBE) HSP 1 Score: 52.4 bits (124), Expect = 4.920e-6 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 0 Query: 17 AKSKWAVFF-REDPSLASEIVSLGKANGEAGHWAVVTLQDTTYYVAGSKNVH 67 A W FF ED + A ++ + KANGEAGH AVV QD +AGSKNVH Sbjct: 167 AAVNWRRFFIGEDAASARHVICMDKANGEAGHVAVVRTQDAYVLLAGSKNVH 218
BLAST of mRNA_M-pyrifera_M_contig108042.1711.1 vs. uniprot
Match: A0A1D1VWU4_RAMVA (Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1VWU4_RAMVA) HSP 1 Score: 49.3 bits (116), Expect = 6.020e-5 Identity = 21/55 (38.18%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 20 KWAVFFREDPSLASEIVSLGKANGEAGHWAVVTLQDTTYYVAGSKNVHCVWEKKQ 74 K+ +F + A ++ K NGEA H+AV ++D Y +AGSKNVH ++ K++ Sbjct: 150 KYEKYFNQPIENAERVICTRKMNGEAAHFAVRWMEDDFYIIAGSKNVHLLFRKRE 204 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108042.1711.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig108042.1711.1 ID=prot_M-pyrifera_M_contig108042.1711.1|Name=mRNA_M-pyrifera_M_contig108042.1711.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=78bpback to top |