mRNA_M-pyrifera_M_contig108042.1711.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108042.1711.1 vs. uniprot
Match: A9V6M3_MONBE (Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V6M3_MONBE) HSP 1 Score: 52.4 bits (124), Expect = 4.920e-6 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 49 AKSKWAVFF-REDPSLASEIVSLGKANGEAGHWAVVTLQDTTYYVAGSKNVH 201 A W FF ED + A ++ + KANGEAGH AVV QD +AGSKNVH Sbjct: 167 AAVNWRRFFIGEDAASARHVICMDKANGEAGHVAVVRTQDAYVLLAGSKNVH 218
BLAST of mRNA_M-pyrifera_M_contig108042.1711.1 vs. uniprot
Match: A0A1D1VWU4_RAMVA (Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1VWU4_RAMVA) HSP 1 Score: 49.3 bits (116), Expect = 6.020e-5 Identity = 21/55 (38.18%), Postives = 34/55 (61.82%), Query Frame = 1 Query: 58 KWAVFFREDPSLASEIVSLGKANGEAGHWAVVTLQDTTYYVAGSKNVHCVWEKKQ 222 K+ +F + A ++ K NGEA H+AV ++D Y +AGSKNVH ++ K++ Sbjct: 150 KYEKYFNQPIENAERVICTRKMNGEAAHFAVRWMEDDFYIIAGSKNVHLLFRKRE 204 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108042.1711.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108042.1711.1 >prot_M-pyrifera_M_contig108042.1711.1 ID=prot_M-pyrifera_M_contig108042.1711.1|Name=mRNA_M-pyrifera_M_contig108042.1711.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=78bp LPSEGEGVGAVKGESDAKSKWAVFFREDPSLASEIVSLGKANGEAGHWAVback to top mRNA from alignment at M-pyrifera_M_contig108042:363..596- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108042.1711.1 ID=mRNA_M-pyrifera_M_contig108042.1711.1|Name=mRNA_M-pyrifera_M_contig108042.1711.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=234bp|location=Sequence derived from alignment at M-pyrifera_M_contig108042:363..596- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108042:363..596- >mRNA_M-pyrifera_M_contig108042.1711.1 ID=mRNA_M-pyrifera_M_contig108042.1711.1|Name=mRNA_M-pyrifera_M_contig108042.1711.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=468bp|location=Sequence derived from alignment at M-pyrifera_M_contig108042:363..596- (Macrocystis pyrifera P11B4 male)back to top |