prot_M-pyrifera_M_contig107623.1620.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Match: A0A6C7E9Y4_ILUCY (Uncharacterized protein n=1 Tax=Ilumatobacter coccineus (strain NBRC 103263 / KCTC 29153 / YM16-304) TaxID=1313172 RepID=A0A6C7E9Y4_ILUCY) HSP 1 Score: 55.8 bits (133), Expect = 5.870e-9 Identity = 28/41 (68.29%), Postives = 36/41 (87.80%), Query Frame = 0 Query: 2 SDAAIVLVVLAAGTFALKAAGPIVLGDRRLPDRVQRVIDLL 42 SDAAIVL+V+ AGT+ LK+AGP+VLG RRLP VQ+++DLL Sbjct: 2 SDAAIVLLVMTAGTYVLKSAGPLVLGTRRLPASVQQLVDLL 42
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Match: A0A7Y1ZXH0_9ACTN (AzlD domain-containing protein n=1 Tax=Ilumatobacter sp. TaxID=1967498 RepID=A0A7Y1ZXH0_9ACTN) HSP 1 Score: 53.5 bits (127), Expect = 4.740e-8 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0 Query: 6 IVLVVLAAGTFALKAAGPIVLGDRRLPDRVQRVIDLL 42 +VL+VLAAGTF LKAAGP+ LG+R LP R+QRV+D+L Sbjct: 6 LVLIVLAAGTFGLKAAGPLALGNRELPVRMQRVVDVL 42
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Match: A0A524MXD8_9ACTN (AzlD domain-containing protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A524MXD8_9ACTN) HSP 1 Score: 48.5 bits (114), Expect = 4.350e-6 Identity = 22/36 (61.11%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 7 VLVVLAAGTFALKAAGPIVLGDRRLPDRVQRVIDLL 42 VL+++ GT+ALK+AGP+VLGDR LP RV++++DLL Sbjct: 7 VLIIMTIGTYALKSAGPLVLGDRVLPLRVRQIVDLL 42
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Match: UPI001C3D31F3 (AzlD domain-containing protein n=1 Tax=Miltoncostaea oceani TaxID=2843216 RepID=UPI001C3D31F3) HSP 1 Score: 47.0 bits (110), Expect = 1.710e-5 Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 0 Query: 11 LAAGTFALKAAGPIVLGDRRLPDRVQRVIDLL 42 LAAGT+A+KAAGP+VLG RRLP V R+ DLL Sbjct: 9 LAAGTYAMKAAGPLVLGGRRLPPGVTRITDLL 40
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Match: UPI001C3D02AD (AzlD domain-containing protein n=1 Tax=Miltoncostaea marina TaxID=2843215 RepID=UPI001C3D02AD) HSP 1 Score: 45.4 bits (106), Expect = 6.700e-5 Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 8 LVVLAAGTFALKAAGPIVLGDRRLPDRVQRVIDLL 42 ++ LAAGT+ALKAAGP++LG R LP V RV DLL Sbjct: 6 ILALAAGTYALKAAGPLLLGGRELPGLVARVADLL 40
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Match: UPI00196109D0 (AzlD domain-containing protein n=1 Tax=Tenggerimyces flavus TaxID=1708749 RepID=UPI00196109D0) HSP 1 Score: 45.4 bits (106), Expect = 7.100e-5 Identity = 21/37 (56.76%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 6 IVLVVLAAGTFALKAAGPIVLGDRRLPDRVQRVIDLL 42 I +++LA GTF +KAAGP+VLG+R LP+R++ +I LL Sbjct: 6 ITIILLAVGTFLIKAAGPLVLGERELPERLRSLIALL 42 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107623.1620.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig107623.1620.1 ID=prot_M-pyrifera_M_contig107623.1620.1|Name=mRNA_M-pyrifera_M_contig107623.1620.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=42bpback to top |