prot_M-pyrifera_M_contig1076.1613.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig1076.1613.1 vs. uniprot
Match: D7G0R0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0R0_ECTSI) HSP 1 Score: 78.6 bits (192), Expect = 2.460e-15 Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 0 Query: 1 MKPSVLAASLEKRLLPRAAKMRAAGIEPEFSRDFRSLAQLTDAQFRAWMGRLRVKI 56 MKPSVLAASL KRL+PRA++MR AGIEP F RD+R++AQLT+ QFRAWM R+ K+ Sbjct: 640 MKPSVLAASLGKRLIPRASRMRRAGIEPNFLRDYRAIAQLTEPQFRAWMERMNEKL 695 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig1076.1613.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig1076.1613.1 ID=prot_M-pyrifera_M_contig1076.1613.1|Name=mRNA_M-pyrifera_M_contig1076.1613.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=73bpback to top |