prot_M-pyrifera_M_contig107486.1592.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107486.1592.1 vs. uniprot
Match: UPI001C26617B (glycoside hydrolase family 99-like domain-containing protein n=1 Tax=Geomonas TaxID=2651583 RepID=UPI001C26617B) HSP 1 Score: 53.9 bits (128), Expect = 1.850e-6 Identity = 33/84 (39.29%), Postives = 42/84 (50.00%), Query Frame = 0 Query: 3 VGAIRWDAWYWTKENGYDANRDIVGKTVTIDLYPEQFHVRVPFWGKLNGSEVVVGLE-NSTAVIGQENELASAFGVDFWAFCTY 85 VGAIRWDAWY G L Q+ R+PF+ NG + L +S V+ +E LASA G+D+WAFC Y Sbjct: 24 VGAIRWDAWY-------------AGSPYEYSLSAPQWRGRLPFYAT-NGKDGRASLRADSQEVMDREIVLASAAGIDYWAFCYY 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107486.1592.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig107486.1592.1 ID=prot_M-pyrifera_M_contig107486.1592.1|Name=mRNA_M-pyrifera_M_contig107486.1592.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=86bpback to top |