mRNA_M-pyrifera_M_contig107486.1592.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107486.1592.1 vs. uniprot
Match: UPI001C26617B (glycoside hydrolase family 99-like domain-containing protein n=1 Tax=Geomonas TaxID=2651583 RepID=UPI001C26617B) HSP 1 Score: 53.9 bits (128), Expect = 1.850e-6 Identity = 33/84 (39.29%), Postives = 42/84 (50.00%), Query Frame = 1 Query: 7 VGAIRWDAWYWTKENGYDANRDIVGKTVTIDLYPEQFHVRVPFWGKLNGSEVVVGLE-NSTAVIGQENELASAFGVDFWAFCTY 255 VGAIRWDAWY G L Q+ R+PF+ NG + L +S V+ +E LASA G+D+WAFC Y Sbjct: 24 VGAIRWDAWY-------------AGSPYEYSLSAPQWRGRLPFYAT-NGKDGRASLRADSQEVMDREIVLASAAGIDYWAFCYY 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107486.1592.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig107486.1592.1 >prot_M-pyrifera_M_contig107486.1592.1 ID=prot_M-pyrifera_M_contig107486.1592.1|Name=mRNA_M-pyrifera_M_contig107486.1592.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=86bp VRVGAIRWDAWYWTKENGYDANRDIVGKTVTIDLYPEQFHVRVPFWGKLNback to top mRNA from alignment at M-pyrifera_M_contig107486:202..459- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig107486.1592.1 ID=mRNA_M-pyrifera_M_contig107486.1592.1|Name=mRNA_M-pyrifera_M_contig107486.1592.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig107486:202..459- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig107486:202..459- >mRNA_M-pyrifera_M_contig107486.1592.1 ID=mRNA_M-pyrifera_M_contig107486.1592.1|Name=mRNA_M-pyrifera_M_contig107486.1592.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=516bp|location=Sequence derived from alignment at M-pyrifera_M_contig107486:202..459- (Macrocystis pyrifera P11B4 male)back to top |