prot_M-pyrifera_M_contig107462.1590.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107462.1590.1 vs. uniprot
Match: A0A7S4NIP6_9EUKA (Hypothetical protein n=1 Tax=Paramoeba aestuarina TaxID=180227 RepID=A0A7S4NIP6_9EUKA) HSP 1 Score: 47.8 bits (112), Expect = 8.300e-5 Identity = 19/54 (35.19%), Postives = 36/54 (66.67%), Query Frame = 0 Query: 1 IQDLKRDVRGQMLTVAALLTQLRLMFTPLQQAKYLVWTRRNPACMQLVNSLWKD 54 + +++ V + T+ LT+++LM TP+QQAK+L W +N A ++L+ S+W+ Sbjct: 231 VHEVRNQVLRWLTTMKCHLTEIQLMLTPIQQAKFLWWAEQNMAVLKLIESMWRS 284 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107462.1590.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig107462.1590.1 ID=prot_M-pyrifera_M_contig107462.1590.1|Name=mRNA_M-pyrifera_M_contig107462.1590.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bpback to top |