mRNA_M-pyrifera_M_contig107462.1590.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107462.1590.1 vs. uniprot
Match: A0A7S4NIP6_9EUKA (Hypothetical protein n=1 Tax=Paramoeba aestuarina TaxID=180227 RepID=A0A7S4NIP6_9EUKA) HSP 1 Score: 47.8 bits (112), Expect = 8.300e-5 Identity = 19/54 (35.19%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 IQDLKRDVRGQMLTVAALLTQLRLMFTPLQQAKYLVWTRRNPACMQLVNSLWKD 162 + +++ V + T+ LT+++LM TP+QQAK+L W +N A ++L+ S+W+ Sbjct: 231 VHEVRNQVLRWLTTMKCHLTEIQLMLTPIQQAKFLWWAEQNMAVLKLIESMWRS 284 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107462.1590.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig107462.1590.1 >prot_M-pyrifera_M_contig107462.1590.1 ID=prot_M-pyrifera_M_contig107462.1590.1|Name=mRNA_M-pyrifera_M_contig107462.1590.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bp IQDLKRDVRGQMLTVAALLTQLRLMFTPLQQAKYLVWTRRNPACMQLVNSback to top mRNA from alignment at M-pyrifera_M_contig107462:54..218+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig107462.1590.1 ID=mRNA_M-pyrifera_M_contig107462.1590.1|Name=mRNA_M-pyrifera_M_contig107462.1590.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=165bp|location=Sequence derived from alignment at M-pyrifera_M_contig107462:54..218+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig107462:54..218+ >mRNA_M-pyrifera_M_contig107462.1590.1 ID=mRNA_M-pyrifera_M_contig107462.1590.1|Name=mRNA_M-pyrifera_M_contig107462.1590.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig107462:54..218+ (Macrocystis pyrifera P11B4 male)back to top |