prot_M-pyrifera_M_contig107042.1506.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107042.1506.1 vs. uniprot
Match: UPI00138F234C (hypothetical protein n=1 Tax=Sphingomonas sp. Leaf28 TaxID=1735695 RepID=UPI00138F234C) HSP 1 Score: 50.8 bits (120), Expect = 6.420e-7 Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 1 MTIETGFDALMTFICVRLGYCGCVKREQAFDVTLLIPDRGVVTADQF 47 MT F AL+T +CV G+CG V ++ VT +PDRG+VT DQF Sbjct: 1 MTDREPFHALITEVCVERGWCGSVVDDRPMHVTDFLPDRGMVTVDQF 47 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107042.1506.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig107042.1506.1 ID=prot_M-pyrifera_M_contig107042.1506.1|Name=mRNA_M-pyrifera_M_contig107042.1506.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bpback to top |