mRNA_M-pyrifera_M_contig107042.1506.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig107042.1506.1 vs. uniprot
Match: UPI00138F234C (hypothetical protein n=1 Tax=Sphingomonas sp. Leaf28 TaxID=1735695 RepID=UPI00138F234C) HSP 1 Score: 50.8 bits (120), Expect = 6.420e-7 Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 1 Query: 1 MTIETGFDALMTFICVRLGYCGCVKREQAFDVTLLIPDRGVVTADQF 141 MT F AL+T +CV G+CG V ++ VT +PDRG+VT DQF Sbjct: 1 MTDREPFHALITEVCVERGWCGSVVDDRPMHVTDFLPDRGMVTVDQF 47 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig107042.1506.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig107042.1506.1 >prot_M-pyrifera_M_contig107042.1506.1 ID=prot_M-pyrifera_M_contig107042.1506.1|Name=mRNA_M-pyrifera_M_contig107042.1506.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bp MTIETGFDALMTFICVRLGYCGCVKREQAFDVTLLIPDRGVVTADQFAEback to top mRNA from alignment at M-pyrifera_M_contig107042:475..621+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig107042.1506.1 ID=mRNA_M-pyrifera_M_contig107042.1506.1|Name=mRNA_M-pyrifera_M_contig107042.1506.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=147bp|location=Sequence derived from alignment at M-pyrifera_M_contig107042:475..621+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig107042:475..621+ >mRNA_M-pyrifera_M_contig107042.1506.1 ID=mRNA_M-pyrifera_M_contig107042.1506.1|Name=mRNA_M-pyrifera_M_contig107042.1506.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig107042:475..621+ (Macrocystis pyrifera P11B4 male)back to top |