prot_M-pyrifera_M_contig105209.1118.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105209.1118.1 vs. uniprot
Match: A0A7W0KJ47_9ACTN (Restriction endonuclease n=1 Tax=Geodermatophilaceae bacterium TaxID=1882271 RepID=A0A7W0KJ47_9ACTN) HSP 1 Score: 65.9 bits (159), Expect = 2.270e-11 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 0 Query: 3 MSLTDAAEQVLRGHSPGAPMHYRAITERGIDLGLIEPGGPTPEA 46 +SL D AE VLR HS GAPMHYR +TE G+ GLI PGGPTPEA Sbjct: 4 LSLADKAEDVLRRHSKGAPMHYRRLTEIGLVEGLIVPGGPTPEA 47
BLAST of mRNA_M-pyrifera_M_contig105209.1118.1 vs. uniprot
Match: A0A353C2E9_9FIRM (Restriction endonuclease n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A353C2E9_9FIRM) HSP 1 Score: 51.6 bits (122), Expect = 2.420e-6 Identity = 23/43 (53.49%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 3 MSLTDAAEQVLRGHSPGAPMHYRAITERGIDLGLIEPGGPTPE 45 +S TDAAE VL + PMHY+ ITE+ I+LGLI G TP+ Sbjct: 101 LSFTDAAEHVLEKYGKKQPMHYKTITEKAIELGLIATAGQTPD 143
BLAST of mRNA_M-pyrifera_M_contig105209.1118.1 vs. uniprot
Match: A0A1V5PLE8_9CHLR (Mrr restriction system protein n=1 Tax=Chloroflexi bacterium ADurb.Bin360 TaxID=1852861 RepID=A0A1V5PLE8_9CHLR) HSP 1 Score: 50.1 bits (118), Expect = 8.480e-6 Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 0 Query: 3 MSLTDAAEQVLRGHSPGAPMHYRAITERGIDLGLIEPGGPTPEA 46 +S T AAE+VL ++ PMHYR ITE+ ++LGL+ G TPEA Sbjct: 103 LSFTSAAEKVLSEYANKQPMHYRVITEKILELGLVNTQGQTPEA 146
BLAST of mRNA_M-pyrifera_M_contig105209.1118.1 vs. uniprot
Match: A0A1J5AAU0_9CHLR (Restriction endonuclease n=1 Tax=Anaerolineae bacterium CG2_30_64_16 TaxID=1805005 RepID=A0A1J5AAU0_9CHLR) HSP 1 Score: 49.3 bits (116), Expect = 1.430e-5 Identity = 24/43 (55.81%), Postives = 28/43 (65.12%), Query Frame = 0 Query: 4 SLTDAAEQVLRGHSPGAPMHYRAITERGIDLGLIEPGGPTPEA 46 S TDAAE VL P+HYRAITE+ + LGL+ G TPEA Sbjct: 17 SFTDAAEAVLEQFGHKQPVHYRAITEKALTLGLVNTKGLTPEA 59
BLAST of mRNA_M-pyrifera_M_contig105209.1118.1 vs. uniprot
Match: A0A7C5MJH2_9BACT (Restriction endonuclease n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A7C5MJH2_9BACT) HSP 1 Score: 48.9 bits (115), Expect = 2.180e-5 Identity = 23/44 (52.27%), Postives = 30/44 (68.18%), Query Frame = 0 Query: 3 MSLTDAAEQVLRGHSPGAPMHYRAITERGIDLGLIEPGGPTPEA 46 +S TD+AE+VL PMHYRAITE+ ++L L+ G TPEA Sbjct: 98 LSFTDSAEKVLEEFGNKQPMHYRAITEKAMELQLLATEGKTPEA 141 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105209.1118.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig105209.1118.1 ID=prot_M-pyrifera_M_contig105209.1118.1|Name=mRNA_M-pyrifera_M_contig105209.1118.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=46bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|