prot_M-pyrifera_M_contig104729.1015.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104729.1015.1 vs. uniprot
Match: A0A7X6P267_9ACTN (Uncharacterized protein n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7X6P267_9ACTN) HSP 1 Score: 48.1 bits (113), Expect = 9.470e-5 Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 1 MSHIVIHEDSNNGTHYAEFDDVQEAVAHLEQLVNEDSGANARLFALEPVEFAVKSYVKVEINSADTDPPAPVSA 74 MSH+VI + + Y +F+ V+E+VA +E L NE + +A++F L+ V+F + Y +V++ P P A Sbjct: 1 MSHMVIFQTPDGDQGYNQFETVEESVAFVESLRNEQNVLSAKIFKLDEVKFEFRPYFRVQLAQLGAGDPPPAYA 74 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104729.1015.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104729.1015.1 ID=prot_M-pyrifera_M_contig104729.1015.1|Name=mRNA_M-pyrifera_M_contig104729.1015.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bpback to top |