mRNA_M-pyrifera_M_contig104729.1015.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104729.1015.1 vs. uniprot
Match: A0A7X6P267_9ACTN (Uncharacterized protein n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7X6P267_9ACTN) HSP 1 Score: 48.1 bits (113), Expect = 9.470e-5 Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 1 Query: 1 MSHIVIHEDSNNGTHYAEFDDVQEAVAHLEQLVNEDSGANARLFALEPVEFAVKSYVKVEINSADTDPPAPVSA 222 MSH+VI + + Y +F+ V+E+VA +E L NE + +A++F L+ V+F + Y +V++ P P A Sbjct: 1 MSHMVIFQTPDGDQGYNQFETVEESVAFVESLRNEQNVLSAKIFKLDEVKFEFRPYFRVQLAQLGAGDPPPAYA 74 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104729.1015.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104729.1015.1 >prot_M-pyrifera_M_contig104729.1015.1 ID=prot_M-pyrifera_M_contig104729.1015.1|Name=mRNA_M-pyrifera_M_contig104729.1015.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bp MSHIVIHEDSNNGTHYAEFDDVQEAVAHLEQLVNEDSGANARLFALEPVEback to top mRNA from alignment at M-pyrifera_M_contig104729:255..500+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104729.1015.1 ID=mRNA_M-pyrifera_M_contig104729.1015.1|Name=mRNA_M-pyrifera_M_contig104729.1015.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=246bp|location=Sequence derived from alignment at M-pyrifera_M_contig104729:255..500+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104729:255..500+ >mRNA_M-pyrifera_M_contig104729.1015.1 ID=mRNA_M-pyrifera_M_contig104729.1015.1|Name=mRNA_M-pyrifera_M_contig104729.1015.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=492bp|location=Sequence derived from alignment at M-pyrifera_M_contig104729:255..500+ (Macrocystis pyrifera P11B4 male)back to top |