prot_M-pyrifera_M_contig104043.860.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104043.860.1 vs. uniprot
Match: UPI00055E8A3C (GNAT family N-acetyltransferase n=1 Tax=Streptomyces yeochonensis TaxID=89050 RepID=UPI00055E8A3C) HSP 1 Score: 50.1 bits (118), Expect = 3.700e-5 Identity = 34/96 (35.42%), Postives = 47/96 (48.96%), Query Frame = 0 Query: 1 MICLATPRLLLRTWRVED---------GPDLLRLVPGDAPTDGQLLFNSSACSVLGADEPAASGLERFERSWATDGFGIFALESFESGSLIGLAGV 87 M + TPRL+LR WR ED P+++R + GD SV E A +ER ER W T+GFG+FA+E ++G G G+ Sbjct: 1 MTTIETPRLVLRRWREEDVEPYAAVNADPEVMRWI-GDG-------------SVRDTAETRAH-IERIERLWETEGFGLFAVELRDTGEFAGFTGL 81
BLAST of mRNA_M-pyrifera_M_contig104043.860.1 vs. uniprot
Match: A0A1G7GUX7_9RHOB (Protein N-acetyltransferase, RimJ/RimL family n=1 Tax=Celeribacter baekdonensis TaxID=875171 RepID=A0A1G7GUX7_9RHOB) HSP 1 Score: 49.3 bits (116), Expect = 6.400e-5 Identity = 32/82 (39.02%), Postives = 44/82 (53.66%), Query Frame = 0 Query: 6 TPRLLLRTWRVEDGPDLLRLVPGDAPTDGQLLFNSSACSVLGADEPAASGLERFERSWATDGFGIFALESFESGSLIGLAGV 87 T RLLLR W+ ED + GD P + + N S + + AA + FER W GFG+FA+ES ++G LIG G+ Sbjct: 8 TERLLLRGWKPEDHAPFAAMC-GD-PEVMRYIGNGSTRTP----DDAARYIGSFEREWTERGFGLFAVESKQTGGLIGFTGL 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104043.860.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104043.860.1 ID=prot_M-pyrifera_M_contig104043.860.1|Name=mRNA_M-pyrifera_M_contig104043.860.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=102bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|