prot_M-pyrifera_M_contig103752.804.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A667ZST2_9TELE (Plakophilin 3 n=6 Tax=Myripristis murdjan TaxID=586833 RepID=A0A667ZST2_9TELE) HSP 1 Score: 55.5 bits (132), Expect = 7.680e-6 Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 0 Query: 89 ARDEAR--KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDE 152 A+DE R K I L++L CDN ++ +A GA NL +N+ N+VAL + GGI+ L+E ++E DE Sbjct: 381 AKDEVRRYKGISELVRLFNCDNQEVQRYATGATRNLIYENMDNKVALIEEGGIAQLIEALKENDDE 446
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A8J7NUX7_ATRSP (PKP3 protein (Fragment) n=1 Tax=Atractosteus spatula TaxID=7917 RepID=A0A8J7NUX7_ATRSP) HSP 1 Score: 53.1 bits (126), Expect = 4.890e-5 Identity = 31/79 (39.24%), Postives = 52/79 (65.82%), Query Frame = 0 Query: 76 AAALRNVIAEHAGARDEAR--KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDE 152 AA +++ ++ A+ +AR KAIP+L++L D+ ++ +A GA+ NL +N+ N+ AL +AGGI L+E +RE DE Sbjct: 437 AAYIQHECYHNSDAKTQARQLKAIPALVKLFNSDSQDVQRYATGAMRNLIYENLDNKSALIEAGGIPQLIEALREPDDE 515
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A484D2R6_PERFV (Uncharacterized protein n=19 Tax=Percidae TaxID=8165 RepID=A0A484D2R6_PERFV) HSP 1 Score: 52.8 bits (125), Expect = 6.510e-5 Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 0 Query: 89 ARDEAR--KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDE 152 A++E R K I L++L CDN ++ +A GA NL +N+ N+VAL + GGI LVE ++E DE Sbjct: 408 AKNEVRRLKGIGELVRLFNCDNQEVQRYATGATRNLIYENMDNKVALIEEGGIPQLVEALKESDDE 473
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A556TLA6_BAGYA (Plakophilin-3 n=1 Tax=Bagarius yarrelli TaxID=175774 RepID=A0A556TLA6_BAGYA) HSP 1 Score: 52.8 bits (125), Expect = 6.640e-5 Identity = 30/71 (42.25%), Postives = 44/71 (61.97%), Query Frame = 0 Query: 95 KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDEGRTDAALALQLLA 165 KAIP+L+QL +N ++ +A GA NL +N+ N+ AL +AGGIS LV ++E DE R + L L+ Sbjct: 544 KAIPALVQLYSSENQEVQRYATGATRNLIYENMENKTALIEAGGISKLVSALKELDDELRKNVTGILWNLS 614 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103752.804.1 ID=prot_M-pyrifera_M_contig103752.804.1|Name=mRNA_M-pyrifera_M_contig103752.804.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=170bpback to top |