prot_M-pyrifera_M_contig103604.764.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103604.764.1 vs. uniprot
Match: A0A815BAP6_9BILA (Hypothetical protein n=1 Tax=Didymodactylos carnosus TaxID=1234261 RepID=A0A815BAP6_9BILA) HSP 1 Score: 63.5 bits (153), Expect = 2.850e-10 Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = 0 Query: 5 CVWRGVKDNNCTHMKCAMCANEFCYFCGKDSKTWEPAGDEI----IYHHNENWESDPSRCVWFL 64 C G+KD CTHM C C+ ++CYFCGK T E E IY HN NWE +P RC + Sbjct: 202 CGLSGMKDEQCTHMICPNCSQQWCYFCGK---TLEDCDKETRYGTIYDHNVNWECNPLRCPMYF 262
BLAST of mRNA_M-pyrifera_M_contig103604.764.1 vs. uniprot
Match: L1J8G3_GUITC (RING-type domain-containing protein n=1 Tax=Guillardia theta (strain CCMP2712) TaxID=905079 RepID=L1J8G3_GUITC) HSP 1 Score: 51.6 bits (122), Expect = 5.210e-6 Identity = 24/62 (38.71%), Postives = 33/62 (53.23%), Query Frame = 0 Query: 5 CVWRGVKDNNCTHMKCAMCANEFCYFCGKDSKTWEPAGDEI-IYHHNENWESD-PSRCVWFL 64 C G+KD+NCTHM+C C +CYFCGK + + I+ HN W + RC +L Sbjct: 235 CGISGMKDDNCTHMRCLNCNEFWCYFCGKREQDLNKSSTSHGIWAHNVGWPNRLGERCPMYL 296 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103604.764.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103604.764.1 ID=prot_M-pyrifera_M_contig103604.764.1|Name=mRNA_M-pyrifera_M_contig103604.764.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=64bpback to top |