prot_M-pyrifera_M_contig10357.757.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10357.757.1 vs. uniprot
Match: D7FU91_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FU91_ECTSI) HSP 1 Score: 83.2 bits (204), Expect = 6.620e-18 Identity = 46/67 (68.66%), Postives = 52/67 (77.61%), Query Frame = 0 Query: 1 MQSLVVGAGAEVFSPDRIIEEIQICHREAREYTSMYLRRKEKAMEASDMEDLLSSVRHVEKKAKLRK 67 MQSLVVGAGAEVFSPDRIIEEI+I H EA YT YLRRK+ +E S+M+DLL VR E KAK R+ Sbjct: 154 MQSLVVGAGAEVFSPDRIIEEIEISHSEAVAYTDRYLRRKQSMIEKSEMQDLLDRVRSAEDKAKRRR 220 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10357.757.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig10357.757.1 ID=prot_M-pyrifera_M_contig10357.757.1|Name=mRNA_M-pyrifera_M_contig10357.757.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bpback to top |