prot_M-pyrifera_M_contig103437.736.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103437.736.1 vs. uniprot
Match: UPI001D08D851 (trafficking protein particle complex subunit 3 n=2 Tax=Coccinellini TaxID=263631 RepID=UPI001D08D851) HSP 1 Score: 49.7 bits (117), Expect = 5.180e-5 Identity = 32/84 (38.10%), Postives = 44/84 (52.38%), Query Frame = 0 Query: 5 ELLQLTFGAIAARIVREAEGVDSANAQLRALGASMGGRLADDFFASRAAAAALPRCSTFRDAMQSLASYALPQYLGVAGAVGRW 88 EL+ LT+GA+ A++V++AE D QL LG +MG RL +DF A RC +D + S A YLG+ V W Sbjct: 16 ELVTLTYGALVAQMVKDAENTDDVGKQLERLGYNMGVRLIEDFLAKTGTG----RCIDLKDTADKIQS-AFKMYLGLQPNVANW 94 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103437.736.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103437.736.1 ID=prot_M-pyrifera_M_contig103437.736.1|Name=mRNA_M-pyrifera_M_contig103437.736.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bpback to top |