prot_M-pyrifera_M_contig101239.260.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101239.260.1 vs. uniprot
Match: A0A5F9DDW4_RABIT (PKHD1 like 1 n=1 Tax=Oryctolagus cuniculus TaxID=9986 RepID=A0A5F9DDW4_RABIT) HSP 1 Score: 53.1 bits (126), Expect = 2.000e-6 Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 0 Query: 1 IVFAYQVVIDSVYPQYWSAGGGDRVMIVGSGFLDDASREEVLVDGKECRIDSVHSNHTHLFCTSP 65 +VF Y + I ++P S GGG +M+ G+GF + VLV G EC +D + SN+T L C P Sbjct: 1957 VVFEYPLDIQDIHPHQGSFGGGQTLMMTGTGF--NPQNSIVLVCGSECAVDRLSSNYTTLLCKIP 2019
BLAST of mRNA_M-pyrifera_M_contig101239.260.1 vs. uniprot
Match: G1TUG6_RABIT (PKHD1 like 1 n=2 Tax=Oryctolagus cuniculus TaxID=9986 RepID=G1TUG6_RABIT) HSP 1 Score: 53.1 bits (126), Expect = 2.000e-6 Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 0 Query: 1 IVFAYQVVIDSVYPQYWSAGGGDRVMIVGSGFLDDASREEVLVDGKECRIDSVHSNHTHLFCTSP 65 +VF Y + I ++P S GGG +M+ G+GF + VLV G EC +D + SN+T L C P Sbjct: 1968 VVFEYPLDIQDIHPHQGSFGGGQTLMMTGTGF--NPQNSIVLVCGSECAVDRLSSNYTTLLCKIP 2030 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101239.260.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig101239.260.1 ID=prot_M-pyrifera_M_contig101239.260.1|Name=mRNA_M-pyrifera_M_contig101239.260.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bpback to top |