mRNA_M-pyrifera_M_contig9987.22965.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Match: D8LR83_ECTSI (PEROXIDASE_4 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LR83_ECTSI) HSP 1 Score: 73.9 bits (180), Expect = 4.630e-14 Identity = 41/51 (80.39%), Postives = 46/51 (90.20%), Query Frame = 1 Query: 4 SVAAS--IGLALSVGPDATTATVNFETERYGDKELKIATVNKLRQQIRNSV 150 SVAAS +GLAL+V P+A A+VNFETERYGDKELKIATVNKLRQQIRNS+ Sbjct: 70 SVAASFGLGLALAVSPEAAQASVNFETERYGDKELKIATVNKLRQQIRNSL 120
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Match: K8ZA26_NANGC (Uncharacterized protein (Fragment) n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=K8ZA26_NANGC) HSP 1 Score: 50.1 bits (118), Expect = 1.710e-6 Identity = 26/48 (54.17%), Postives = 37/48 (77.08%), Query Frame = 1 Query: 25 LALSVGPDATTATVNFETERYGDKELKIATVNKLRQQIRNSVRTSIDI 168 L+LS P A A+V F+ +RYGDKELKIATVNKL+Q++RN++ + + Sbjct: 35 LSLSSTPPAR-ASVAFDPDRYGDKELKIATVNKLKQKLRNAIAGDLSL 81
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Match: A0A7S1FWQ2_9STRA (Hypothetical protein n=2 Tax=Corethron hystrix TaxID=216773 RepID=A0A7S1FWQ2_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 7.620e-6 Identity = 24/40 (60.00%), Postives = 31/40 (77.50%), Query Frame = 1 Query: 37 VGPDATTATVNFETERYGDKELKIATVNKLRQQIRNSVRT 156 + P ATV F+ +RYGDKELKIATVNKLRQ +R+++ T Sbjct: 76 IQPQEAYATVFFDPDRYGDKELKIATVNKLRQNVRSTILT 115
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Match: W7U1L4_9STRA (L-ascorbate peroxidase n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7U1L4_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 1.010e-5 Identity = 26/48 (54.17%), Postives = 37/48 (77.08%), Query Frame = 1 Query: 25 LALSVGPDATTATVNFETERYGDKELKIATVNKLRQQIRNSVRTSIDI 168 L+LS P A A+V F+ +RYGDKELKIATVNKL+Q++RN++ + + Sbjct: 80 LSLSSTPPAR-ASVAFDPDRYGDKELKIATVNKLKQKLRNAIAGDLSL 126
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Match: A0A7S2QWC3_9STRA (Hypothetical protein (Fragment) n=1 Tax=Triparma pacifica TaxID=91992 RepID=A0A7S2QWC3_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 6.790e-5 Identity = 21/36 (58.33%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 43 PDATTATVNFETERYGDKELKIATVNKLRQQIRNSV 150 P TA+V ++ +RYGDKELKIATVNK+RQ +R+++ Sbjct: 70 PGQATASVFYDPDRYGDKELKIATVNKIRQNVRDAI 105
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Match: A0A7R9UI27_9STRA (Hypothetical protein n=2 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9UI27_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 9.380e-5 Identity = 23/39 (58.97%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 34 SVGPDATTATVNFETERYGDKELKIATVNKLRQQIRNSV 150 S G A +ATV + +RYGDKELKIATV ++QQ+RNS+ Sbjct: 97 SCGGSAASATVFLDPDRYGDKELKIATVASMKQQLRNSI 135 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9987.22965.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig9987.22965.1 >prot_M-pyrifera_M_contig9987.22965.1 ID=prot_M-pyrifera_M_contig9987.22965.1|Name=mRNA_M-pyrifera_M_contig9987.22965.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bp ASVAASIGLALSVGPDATTATVNFETERYGDKELKIATVNKLRQQIRNSVback to top mRNA from alignment at M-pyrifera_M_contig9987:1709..1882- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig9987.22965.1 ID=mRNA_M-pyrifera_M_contig9987.22965.1|Name=mRNA_M-pyrifera_M_contig9987.22965.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=174bp|location=Sequence derived from alignment at M-pyrifera_M_contig9987:1709..1882- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig9987:1709..1882- >mRNA_M-pyrifera_M_contig9987.22965.1 ID=mRNA_M-pyrifera_M_contig9987.22965.1|Name=mRNA_M-pyrifera_M_contig9987.22965.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=348bp|location=Sequence derived from alignment at M-pyrifera_M_contig9987:1709..1882- (Macrocystis pyrifera P11B4 male)back to top |